General Information

  • ID:  hor004164
  • Uniprot ID:  Q924A4
  • Protein name:  Urocortin-3
  • Gene name:  UCN3
  • Organism:  Mus musculus (Mouse)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  Animal
  • Expression:  Expressed in some areas of the brain including the hypothalamus, amygdala, and brainstem, but is not evident in the cerebellum, pituitary, or cerebral cortex; it is also expressed peripherally in small intestine and skin.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0051429 corticotropin-releasing hormone receptor binding; GO:0051431 corticotropin-releasing hormone receptor 2 binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007586 digestion; GO:0009749 response to glucose; GO:0009755 hormone-mediated signaling pathway; GO:0031669 cellular response to nutrient levels; GO:0032024 positive regulation of insulin secretion; GO:0035902 response to immobilization stress; GO:0042594 response to starvation; GO:0045838 positive regulation of membrane potential; GO:0051412 response to corticosterone; GO:0071456 cellular response to hypoxia
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon; GO:0043196 varicosity; GO:0043679 axon terminus

Sequence Information

  • Sequence:  FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI
  • Length:  38(123-160)
  • Propeptide:  MLMPTYFLLPLLLLLGGPRTSLSHKFYNTGPVFSCLNTALSEVKKNKLEDVPLLSKKSFGHLPTQDPSGEEDDNQTHLQIKRTFSGAAGGNGAGSTRYRYQSQAQHKGKLYPDKPKSDRGTKFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQIGKKK
  • Signal peptide:  MLMPTYFLLPLLLLLGGPRTSLS
  • Modification:  T38 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Suppresses food intake, delays gastric emptying and decreases heat-induced edema;m ight represent an endogenous ligand for maintaining homeostasis after stress
  • Mechanism:  UCN3 expression enhances glucose disposal and signalling in muscle by an autocrine/paracrine mechanism that is separate from its pro-hypertrophic effects.
  • Cross BBB:  YES
  • Target:  Crhr2, Crh
  • Target Unid:  Q60748, P35347
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q924A4-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor004164_AF2.pdbhor004164_ESM.pdb

Physical Information

Mass: 483414 Formula: C186H311N51O53S2
Absent amino acids: CEGHWY Common amino acids: A
pI: 10.5 Basic residues: 4
Polar residues: 8 Hydrophobic residues: 19
Hydrophobicity: 30.79 Boman Index: -3018
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 118.42
Instability Index: 5668.95 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  11416224
  • Title:  Identification of urocortin III, an additional member of the corticotropin-releasing factor (CRF) family with high affinity for the CRF2 receptor.
  • PubMed ID:  25122003
  • Title:  Urocortin 3 Activates AMPK and AKT Pathways and Enhances Glucose Disposal in Rat Skeletal Muscle.
  • PubMed ID:  24043794
  • Title:  Urocorti